SOX2_MOUSE P48432
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P48432
Recommended name：Transcription factor SOX-2
EC number：
Alternative names：
Cleaved into：
GeneID：20674
Gene names (primary )：Sox2
Gene names (synonym )：Sox-2
Gene names (ORF )：
Length：319
Mass：34454
Sequence：MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGGGLNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYVVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAKYGTLPLSHM
Tissue specificity：Expressed in the brain and retina. A very low level expression is seen in the stomach and lung. Expressed in developing urogenital ridge. Expressed in the brain, lung and kidney (PubMed:15863505). {ECO:0000269|PubMed:15863505}.
Induction：By SRRT. {ECO:0000269|PubMed:22198669}.
Developmental stage：
Protein families：