SHSA5_MOUSE   Q9D7I0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D7I0

Recommended name:Protein shisa-5

EC number:

Alternative names:(Scotin)

Cleaved into:

GeneID:66940

Gene names  (primary ):Shisa5

Gene names  (synonym ):Scotin

Gene names  (ORF ):

Length:235

Mass:25517

Sequence:MAAPAPSLWTLLLLLLLLPPPPGAHGELCRPFGEDNSIPVFCPDFCCGSCSNQYCCSDVLRKIQWNEEMCPEPESRFSTPAEETPEHLGSALKFRSSFDSDPMSGFGATVAIGVTIFVVFIATIIICFTCSCCCLYKMCCPQRPVVTNTTTTTVVHAPYPQPQPQPVAPSYPGPTYQGYHPMPPQPGMPAAPYPTQYPPPYLAQPTGPPPYHESLAGASQPPYNPTYMDSLKTIP

Tissue specificity:Spleen and thymus.

Induction:Induced in a p53/TP53-dependent manner in response to cellular stress. {ECO:0000269|PubMed:12135983}.

Developmental stage:

Protein families:Shisa family


   💬 WhatsApp