SL2A8_RAT Q9JJZ1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJZ1
Recommended name:Solute carrier family 2, facilitated glucose transporter member 8 Curated
EC number:
Alternative names:
Cleaved into:
GeneID:85256
Gene names (primary ):Slc2a8
Gene names (synonym ):Glut8 1 Publication, Glutx1 1 Publication
Gene names (ORF ):
Length:478
Mass:51,459
Sequence:MSPEDPQETQPLLRSPGARAPGGRRVFLATFAAALGPLSFGFALGYSSPAIPSLRRTAPPALRLGDTAASWFGAVVTLGAAAGGVLGGWLLDRAGRKLSLLLCTVPFVTGFAVITAARDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVTGILLAYVAGWVLEWRWLAVLGCVPPTLMLLLMCYMPETPRFLLTQHQYQEAMAALRFLWGSEEGWEEPPVGAEHQGFQLAMLRRPGVHKPLIIGICLMVFQQLSGVNAIMFYANTIFEEAKFKDSSLASVTVGIIQVLFTAVAALIMDRAGRKLLLALSGVIMVFSMSAFGTYFKLTQSGPSNSSHVGLLVPISAEPADVHLGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHIKGVATGVCVLTNWFMAFLVTKEFNSIMEILRPYGAFWLTAAFCILSVLFTLTFVPETKGRTLEQITAHFEGR
Tissue specificity:Highly expressed in adult and pubertal testis, but not prepubertal testis (PubMed:10821868). Moderate expression in hypothalamus, cerebellum, brainstem, hippocampus, and adrenal gland (PubMed:10821868). Lower amounts present in most other tissues (PubMed:10821868). 1
Induction:
Developmental stage:
Protein families: