CYPT1_MOUSE Q8CH20
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CH20
Recommended name：Cysteine-rich perinuclear theca protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：66742
Gene names (primary )：Cypt1
Gene names (synonym )：Ckt1r3 Cypt5
Gene names (ORF )：
Length：168
Mass：18957
Sequence：MAQMAKKVHWSSAAAGAAAAAKISKLEKTTKRFKLIKKRNPSSKLPKRSSHSLLCSLSRSCCCCRCRCCCYCRCCRCCCSRSRRFRSRTTLKFFQITEKGEQSLQRRIRRQLTRSQLELIEPEPTMALEPSEITVAFFSHKNANVSDPEEVPPCLDSDPFPNGDLASS
Tissue specificity：Specifically expressed in spermatozoa (at protein level). Detected from the elongated spermatid stage onwards; not found in immature germ cells or somatic cells (at protein level). {ECO:0000269|PubMed:15286030}.
Induction：
Developmental stage：Detected from 29 days postpartum onwards, with increasing expression through to the adult stage. {ECO:0000269|PubMed:15286030}.
Protein families：