ABITM_MOUSE Q80ZQ9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80ZQ9
Recommended name：Protein Abitram
EC number：
Alternative names：(Actin-binding transcription modulator) (Protein Simiate)
Cleaved into：
GeneID：230234
Gene names (primary )：Abitram
Gene names (synonym )：Fam206a Simiate
Gene names (ORF )：
Length：193
Mass：21597
Sequence：MEELRCPEAKLAPPEVVIATEAPPPSLVDRYFTRWYKADVKGKPCEDHCILQHSNRICVITLAGSHPVLQSGKAIQRISYQISNNCSRLENKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTISSCVRGRLMEVNENILHQPSLLQEKPSTEGYIAVVLPKFEESKSVTEGLLTQQQYEEVVVKRTNATATTP
Tissue specificity：Detected (at protein level) in liver, lung, heart, spleen, kidney, and ovaries. In brain expression is higher in the hippocampus, the nuclear layer of the cerebellum, the cortex and the caudoputamen. {ECO:0000269|PubMed:24349419}.
Induction：
Developmental stage：
Protein families：ABITRAM family