HSPB3_RAT   Q9QZ58


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZ58

Recommended name:Heat shock protein beta-3

EC number:

Alternative names:

Cleaved into:

GeneID:78951

Gene names  (primary ):Hspb3

Gene names  (synonym ):

Gene names  (ORF ):

Length:152

Mass:17,210

Sequence:MAKIILRHLIETPVRYQEEFEARGLEDCRLDHALYALPGPTIEDLRKARGTPKALAEDSDSAETPPGEGKSRFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVETKDLSAILCHDGILVVEVKDPLETK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp