RARR2_MOUSE   Q9DD06


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DD06

Recommended name:Retinoic acid receptor responder protein 2

EC number:

Alternative names:(Chemerin)

Cleaved into:

GeneID:71660

Gene names  (primary ):Rarres2

Gene names  (synonym ):

Gene names  (ORF ):

Length:162

Mass:18350

Sequence:MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFSRALRTK

Tissue specificity:Expressed in the differentiated adipocytes (at protein level). Abundantly expressed in the liver, adipose tissue including visceral, epididymal, and brown adipose tissue. {ECO:0000269|PubMed:17635925, ECO:0000269|PubMed:17767914, ECO:0000269|PubMed:18242188}.

Induction:Strongly induced during adipocyte differentiation. {ECO:0000269|PubMed:18242188}.

Developmental stage:

Protein families:


   💬 WhatsApp