NPT2B_MOUSE Q9DBP0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DBP0
Recommended name:Sodium-dependent phosphate transport protein 2B
EC number:
Alternative names:(Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (NaPi-2b) (Solute carrier family 34 member 2)
Cleaved into:
GeneID:20531
Gene names (primary ):Slc34a2
Gene names (synonym ):Npt2b
Gene names (ORF ):
Length:697
Mass:76245
Sequence:MAPWPELENAQPNPGKFIEGASGPQSSIPAKDKEASKTNDNGTPVAKTELLPSYSALVLIEEHPEGTDPWDLPELQDTGIKWSERDTKGKTLCIFQGVGKFILLLGFLYLFVCSLDVLSSAFQLVGGKVAGQFFSNNSIMSNPVAGLVIGVLVTVMVQSSSTSSSIIVSMVASSLLTVRAAIPIIMGANIGTSITNTIVALMQAGDRNEFRRAFAGATVHDFFNWLSVFVLLPLEAATHYLEILTNLVLETFKFQNGEDAPDILKVITDPFTKLIIQLDKKVIQQIAMGDSAAQNKSLIKIWCKSITNVTEMNVTVPSTDNCTSPSYCWTDGIQTWTIQNVTQKENIAKCQHIFVNFSLPDLAVGIILLTVSLVVLCGCLIMIVKLLGSVLRGQVATVIKKTLNTDFPFPFAWLTGYLAILVGAGMTFIVQSSSVFTSAMTPLIGIGVISIERAYPLTLGSNIGTTTTAILAALASPGNTLRSSLQIALCHFFFNISGILLWYPIPFTRLPIRLAKGLGNISAKYRWFAVFYLIFFFFVTPLTVFGLSLAGWPVLVGVGVPIILLLLLVLCLRMLQFRCPRILPLKLRDWNFLPLWMHSLKPWDNVISLATTCFQRRCCCCCRVCCRVCCMVCGCKCCRCSKCCRDQGEEEEEKEQDIPVKASGAFDNAAMSKECQDEGKGQVEVLSMKALSNTTVF
Tissue specificity:Highly abundant in the ileum of small intestine, whereas it is almost absent in the duodenum and in the jejunum. {ECO:0000269|PubMed:15701623}.
Induction:Up-regulated in the entire small intestine by low-phosphate diet. Up-regulated by metabolic acidosis. {ECO:0000269|PubMed:15701623, ECO:0000269|PubMed:15701624}.
Developmental stage:
Protein families:SLC34A transporter family