CDNF_MOUSE Q8CC36
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CC36
Recommended name：Cerebral dopamine neurotrophic factor
EC number：
Alternative names：(ARMET-like protein 1) (Conserved dopamine neurotrophic factor)
Cleaved into：
GeneID：227526
Gene names (primary )：Cdnf
Gene names (synonym )：Armetl1
Gene names (ORF )：
Length：187
Mass：21032
Sequence：MRCISPTALVTFCAGFCISNPVLAQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL
Tissue specificity：Expressed at high levels in the heart, skeletal muscle, testis and brain (at protein level). In the brain, detected in the cerebral cortex neurons through layers II to VI. In the hippocampus, detected in the CA1 to CA3 pyramidal regions and in the granule and polymorph layers of dentate gyrus. Weak expression in the striatum. In substantia nigra, detected in solitary cells that did not express tyrosine hydroxylase, a marker for dopaminergic neurons. Relatively high expression in the Purkinje cells of the cerebellum and in regions of the brain stem, including the locus coeruleus. {ECO:0000269|PubMed:17611540}.
Induction：
Developmental stage：At postnatal stage P1 and P10, expressed in the brain, including the hippocampus, thalamus, striatum and substantia nigra. Highest levels in the hippocampus and thalamus. {ECO:0000269|PubMed:17611540}.
Protein families：ARMET family