MEIS1_MOUSE Q60954
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60954
Recommended name：Homeobox protein Meis1
EC number：
Alternative names：(Myeloid ecotropic viral integration site 1)
Cleaved into：
GeneID：17268
Gene names (primary )：Meis1
Gene names (synonym )：
Gene names (ORF )：
Length：390
Mass：43002
Sequence：MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDVTRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM
Tissue specificity：Expressed at high levels in the lung with lower levels detected in the heart and brain. Expressed in pancreatic islets (beta-cells and non-beta-cells) (PubMed:21059917). {ECO:0000269|PubMed:21059917}.
Induction：Expression is coactivated by retroviral integration in BXH-2 murine myeloid leukemias.
Developmental stage：Expressed at high levels in all stages of embryonic development analyzed (7 days to 17 days).
Protein families：TALE/MEIS homeobox family