F162A_MOUSE Q9D6U8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D6U8
Recommended name：Protein FAM162A
EC number：
Alternative names：(E2-induced gene 5 protein homolog) (Growth and transformation-dependent protein) (HGTD-P)
Cleaved into：
GeneID：70186
Gene names (primary )：Fam162a
Gene names (synonym )：E2ig5
Gene names (ORF )：
Length：155
Mass：17725
Sequence：MWSLGGLRLAAGHCLRLYERNASSSLRFTRNTDLKRINGFCTKPQESPKTPTQSYRHGVPLHKPTDFEKKILLWSGRFKKEEEIPETISFEMLDAAKNKLRVKVSYLMIALTVAGCIYMVIEGKKAAKRHESLTSLNLERKARLREEAAMKAKTD
Tissue specificity：
Induction：Induced by hypoxia. {ECO:0000269|PubMed:17316997}.
Developmental stage：
Protein families：UPF0389 family