DEF4_RAT Q62714
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62714
Recommended name:Defensin alpha 4 By Similarity
EC number:
Alternative names:
Cleaved into:
GeneID:286958
Gene names (primary ):Np4 1 Publication
Gene names (synonym ):
Gene names (ORF ):
Length:93
Mass:10,110
Sequence:MRTLTLLITLLLLALHTQAESPQERAKAAPDQDMVMEDQDIFISFGGYKGTVLQDAVVKAGQACYCRIGACVSGERLTGACGLNGRIYRLCCR
Tissue specificity:Expressed in neutrophils (at protein level) (PubMed:2543629). Highest expression in bone marrow and to a much lesser extent in small intestine (PubMed:7594610). 2 s
Induction:
Developmental stage:
Protein families: