KNCN_MOUSE   Q307W7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q307W7

Recommended name:Kinocilin

EC number:

Alternative names:

Cleaved into:

GeneID:654462

Gene names  (primary ):Kncn

Gene names  (synonym ):Kino

Gene names  (ORF ):

Length:124

Mass:12809

Sequence:MDIPISTRDFRCLQLACVALGLVAGSIIIGVSVSKAAAAVGGIFLGAAGLGLLIFAYPFLKARFNLDHILPAIGNLRIHPNSGPDHGEGRSSNNSNKEGARSGLSTVTRTLEKLKPGGRGTEEG

Tissue specificity:Preferentially expressed in the inner ear and testis. Localizes mainly in the kinocilium of sensory cells in the inner ear. Also present in the manchette of the spermatids, a transient structure enriched in interconnected microtubules (at protein level).

Induction:

Developmental stage:First detected in the kinocilia of vestibular and auditory hair cells at embryonic days 14.5, and 18.5, respectively. In the mature vestibular hair cells, it is still present in the kinocilium. As the auditory hair cells begin to lose the kinocilium during postnatal development, it becomes distributed in an annular pattern at the apex of these cells, where it colocalizes with the tubulin belt. In mature auditory hair cells, it is also present at the level of the cuticular plate, at the base of each stereocilium. As the kinocilium regresses from developing auditory hair cells, it begins to be expressed by the pillar cells and Deiters cells, that both contain prominent transcellular and apical bundles of microtubules. Not detected in the supporting cells in the vestibular end organs (at protein level).

Protein families:


   💬 WhatsApp