FMOD_MOUSE   P50608


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P50608

Recommended name:Fibromodulin

EC number:

Alternative names:(FM) (Collagen-binding 59 kDa protein) (Keratan sulfate proteoglycan fibromodulin) (KSPG fibromodulin)

Cleaved into:

GeneID:14264

Gene names  (primary ):Fmod

Gene names  (synonym ):

Gene names  (ORF ):

Length:376

Mass:43055

Sequence:MQWASVLLLAGLCSLSQGQYDEDSHWWIQYLRNQQSTYYDPYDPYPYEPSEPYPYGVEEGPAYAYGAPPPPEPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQISAIQEGVFDNATGLLWVALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLHHNEIQEVGSSMRGLRSLILLDLSYNHLRRVPDGLPSALEQLYLEHNNVYTVPDSYFRGSPKLLYVRLSHNSLTNNGLATNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVMNFSKLQVLRLDGNEIKRSAMPVDAPLCLRLANLIEI

Tissue specificity:Highest levels observed in knee epiphysis, in calvarial and diaphyseal bone, in nasal and costal cartilage, in the eye, and in bladder. In mature knee joint it is mostly present in the proliferating zone of growth plate. It is also observed in ligaments, especially at insertion sites, in the junction between meniscus and joint capsule, in the perimysium of skeletal muscle and in the periosteum.

Induction:

Developmental stage:Highest levels between 5 days and 1 month of age. Thereafter, the expression of declined to a level of approx. 35% of maximum, and remained constant throughout the rest of the observation period.

Protein families:Small leucine-rich proteoglycan (SLRP) family, SLRP class II subfamily


   💬 WhatsApp