CD24_RAT Q07490
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q07490
Recommended name：Signal transducer CD24
EC number：
Alternative names：CD24
Cleaved into：
GeneID：25145
Gene names (primary )：Cd24
Gene names (synonym )：Cd24a
Gene names (ORF )：
Length：76
Mass：7,862
Sequence：MGRAMVVRLGLGLLLLALLLPTQIYCNQTSVAPFSGNQSISAAPNPTNATTRSGCSSLQSTAGLLALSLSLLHLYC
Tissue specificity：Expressed in the central nervous system, in postmitotic cells of spinal cord, hindbrain, midbrain and forebrain. Expressed in epithelium during the development of non-neural tissues. Expressed in tooth development, specifically in mesenchymal cells differentiating into odontoblast in dental papilla, as well as in the developing eye and hair follicle.
Induction：
Developmental stage：Detected in primitive ectoderm, mesoderm and ventral endoderm; down-regulated when organogenesis is completed.
Protein families：