TIMP4_RAT   P81556


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P81556

Recommended name:Metalloproteinase inhibitor 4

EC number:

Alternative names:

Cleaved into:

GeneID:680130

Gene names  (primary ):Timp4

Gene names  (synonym ):

Gene names  (ORF ):

Length:224

Mass:25,723

Sequence:MPWSPLAALSWALVLRLLALLWPPGRGEACSCAPAHPQQHVCHSALVIRAKISSEKVVPASEDPADTQKMIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSQKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPDECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIVQP

Tissue specificity:Expressed in retina, smooth muscle, skin, pancreas, skeletal muscle, heart, brain, lung, kidney and testis. Not found in cartilage, spleen and liver.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp