CPSF5_MOUSE Q9CQF3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQF3
Recommended name:Cleavage and polyadenylation specificity factor subunit 5
EC number:
Alternative names:(Nucleoside diphosphate-linked moiety X motif 21) (Nudix motif 21) (Nudix hydrolase 21)
Cleaved into:
GeneID:68219
Gene names (primary ):Nudt21
Gene names (synonym ):Cpsf5
Gene names (ORF ):
Length:227
Mass:26240
Sequence:MSVVPPNRSQTGWPRGVNQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Tissue specificity:Expressed in testis (PubMed:18032416). Expressed in male germ cells (at protein level) (PubMed:18032416). {ECO:0000269|PubMed:18032416}.
Induction:Up-regulated during spermatogenesis (PubMed:18032416). {ECO:0000269|PubMed:18032416}.
Developmental stage:
Protein families:Nudix hydrolase family, CPSF5 subfamily