NB5R3_MOUSE   Q9DCN2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DCN2

Recommended name:NADH-cytochrome b5 reductase 3

EC number:EC 1.6.2.2

Alternative names:(B5R) (Cytochrome b5 reductase) (Diaphorase-1)

Cleaved into:NADH-cytochrome b5 reductase 3 membrane-bound form; NADH-cytochrome b5 reductase 3 soluble form

GeneID:109754

Gene names  (primary ):Cyb5r3

Gene names  (synonym ):Dia1

Gene names  (ORF ):

Length:301

Mass:34128

Sequence:MGAQLSTLSHVVLSPVWFIYSLFMKLFQRSTPAITLENPDIKYPLRLIDKEVISPDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSARFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPTPGEEPLILMCGPPPMIQFACLPNLERVGHPKERCFTF

Tissue specificity:

Induction:

Developmental stage:

Protein families:Flavoprotein pyridine nucleotide cytochrome reductase family


   💬 WhatsApp