22P1_RAT P22282
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22282
Recommended name：Cystatin-related protein 1
EC number：
Alternative names：Androgen-regulated 20 kDa protein Prostatic 22 kDa glycoprotein P22K16/P22K20
Cleaved into：
GeneID：25030
Gene names (primary )：Andpro
Gene names (synonym )：Crp1
Gene names (ORF )：
Length：176
Mass：21,060
Sequence：MCKTLHGTLLLLAIFVLFLNFSHATAKRTRRGMEIFEKNFIDKNKLKDVYDVFKYLYNTHSADTYLSNIKNESFTMNIWGFGEIEMVKTKCRKIDSDFYKCSFQREFYNLKRTPGETMYYISLPGSVRCRKLLSKLDNCPFEEQTEQLKREICYFVVYPDYIEQNIHAVRFDCYTK
Tissue specificity：Prostate and lacrimal gland.
Induction：
Developmental stage：By androgens.
Protein families：