NDUF4_RAT Q9NQR8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NQR8
Recommended name:NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4
EC number:
Alternative names:
Cleaved into:
GeneID:362495
Gene names (primary ):Ndufaf4
Gene names (synonym ):Hrpap20
Gene names (ORF ):
Length:174
Mass:20,158
Sequence:MGARMTRAFRNFNVEKRAEQEISKRKPSMAPKHPSTRSLLQEHLSQYPEIEEEVSRKDNKLLSLLRDVYVNSKDPVPSLPVKAIEPQQQPKEFRLPIGDQFDKNIKDIPKGKITVVEALTLLNNHKLSPETWTAEKIAQEYHLELEDVNSLLKYFVTFEVKIVPPEDRKAIQSK
Tissue specificity:Expression is low in quiescent cells and is induced in exponentially proliferating cultures. Expression is also induced when prolactin is added to stationary cells. Induced by dietary differentiating agents such as butyrate, vitamin D3, and retinoic acid. 1
Induction:
Developmental stage:
Protein families: