PR6A1_MOUSE O35257
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35257
Recommended name：Prolactin-6A1
EC number：
Alternative names：(Placental prolactin-like protein B) (PLP-B) (PRL-like protein B)
Cleaved into：
GeneID：19111
Gene names (primary )：Prl6a1
Gene names (synonym )：Prlpb
Gene names (ORF )：
Length：230
Mass：26621
Sequence：MLSLSQPCFSGTLLMLLASNFLLWKNVAPVPMYASLDEYGEMSIYDLLDHVTILSHNVSELTAEMHRIFMEDVRYKPGRWFSDRYLTACHTSTLTISVSKEGARQMPGVFLVKEMISMLTAWRYPLYHIITELSYMEQAPDEIISRARNIEEKIIVLIEALRGILSKIQPGPPENERYPVWNELASLQSPDEDLRHLTLFNLFQCLVKDSRKIDSSIRLLKCKLLYNRDC
Tissue specificity：Expressed in both placenta and decidual tissues. Detected first in deciduals cells early in gestation and in trophoblasts later in pregnancy. {ECO:0000269|PubMed:9389542, ECO:0000269|PubMed:9472921}.
Induction：
Developmental stage：Increased gradually from days 8-12 and decrease to low levels by days 16. {ECO:0000269|PubMed:9389542, ECO:0000269|PubMed:9472921}.
Protein families：Somatotropin/prolactin family