HEMGN_RAT Q6AZ54
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6AZ54
Recommended name：Hemogen
EC number：
Alternative names：
Cleaved into：
GeneID：113882
Gene names (primary )：Hemgn
Gene names (synonym )：Rp59
Gene names (ORF )：
Length：514
Mass：56,573
Sequence：MDVRKDQSHLTLNQTPEAHVEKSHAPDIIGSWSLRNREQLKKRKAEAQGRQTSQWQLGEQKKRKYQRTGKGNRRGRKRQGNVEQKAESWSQTENERVQEVLVPAEEETEYSGNTATQALPLRASPTKAVPTEHCSEVPQESLQCQEITIQNHSQTHQRRDKAEALSPTTCQEIGVLQYSPKMCQDMAEPEARSPKMCQETAVPQTYSPKAHEDMAEYEALSPKMCRETPVPQYHSSKIPQDMTGPEALAPDMCQETTVSQNHSSKVPQDMAGPEALSLKMCQEPTVLQEHTLKICQDVARPDVLSSKTHQEMTVPKALPCITPGDAAGPEGCSPKTLPQSDVTPMSVTPGKNTSHPDLGTAVAEGCFSEAGECIVSEDISTKTHQEAVEPKFLSHKTYKEFTVPIVSSHKTIQESPGPEEYSPGSRHEMSGPEDLSIKTCKNRDGPKHSLPEGAQEVGGAQRQDPDAQDIEDAGAFSQDLEEGNKADQDPETPAGPQGPQKICPENDVHSSALF
Tissue specificity：Expressed by bone marrow cells and osteoblasts. Also expressed by ameloblasts in tooth enamel (at protein level). Expressed in enamel organ, ameloblasts, spleen, bone marrow cells and osteoblasts. 3 s
Induction：
Developmental stage：At 9 dpc expressed in extraembryonic mesodermal layers with its prospective blood islands. Expressed in blood islands at day 12 dpc. Expressed by the intraembryonic primary ectoderm including the primitive streak at day 9 dpc. Expressed in the fetal liver and in circulating cells at 17 dpc, the liver expression disappear around birth (at protein level). 1
Protein families：