ROP1_MOUSE   Q9ESG2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ESG2

Recommended name:Ropporin-1

EC number:

Alternative names:(Rhophilin-associated 'oppo' protein) (Rhophilin-associated protein 1)

Cleaved into:

GeneID:76378

Gene names  (primary ):Ropn1

Gene names  (synonym ):

Gene names  (ORF ):

Length:212

Mass:24003

Sequence:MPQTDKQVCIPPELPELLKQFTKDAIRTQPPDLIQWAAEYFGAMSRGEIPPVRERSEQIPLSNWAELTPELLKVLHSRVAGRLIIHADELAQMWKVLNLPTDLFNSVMNVGRFTEEIEWLKFLALACSSLGVTIAKTLKIVCEVLSSDHDGGPPRIPFSTFQFLYTYIAEVDGEISSSHVSRMLNYIEQEVIGPDGLIKVNDFTQNPRVRLE

Tissue specificity:Testis-specific. Present in the most inner parts of seminiferous tubules (at protein level). {ECO:0000269|PubMed:10591629, ECO:0000269|PubMed:23303679}.

Induction:

Developmental stage:Expression in testis starts at P21, and increases to reach a plateau at P27 (PubMed:10591629). Expressed in the flagella of sperm at all stages of development in the testis and epididymis (PubMed:23303679). {ECO:0000269|PubMed:10591629, ECO:0000269|PubMed:23303679}.

Protein families:Ropporin family


   💬 WhatsApp