BSND_RAT Q8R2H3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R2H3
Recommended name：Barttin
EC number：
Alternative names：
Cleaved into：
GeneID：192675
Gene names (primary )：Bsnd
Gene names (synonym )：
Gene names (ORF )：
Length：308
Mass：33,895
Sequence：MADEKTFRIGFIVLGLFLLSLGTFLMSHDRPQVYGTFYAMGSIMVIGGVLWSMCQCYPKITFVPADSDFQGMLSPKALSLLETGLSEVKSPQPPYVRLWEEAAYDQSLPDFTHIQMKVMGYSEDPRPLLAPELKTGTSSAKEGEPHSAQTWMEAAVVVHRELDEKEGEKSRSQSSPPACSQGSAPLASFHDDLDVGSSEGRSPQPSPPDRDEAHLQVPWASRGPLDRFGDFALIDDTPISEDMGLEGQAQEEALPSKQPWSLRMKEETVQAGAEEPEQEEEDLYYGLPDSPGDPLPDKELGFEPDVQG
Tissue specificity：Expressed along the distal nephron. 1
Induction：
Developmental stage：Regulated in parallel with CLCNKA under furosemide treatment. A significant decrease occurred after furosemide treatment in inner medulla (0.5 fold), whereas cortical and outer medulla levels remained unaffected. Regulation with CLCNKA in inner medulla is limited to the thin limb; levels in collecting ducts were not affected by furosemide treatment. During furosemide treatment selective down-regulation with CLCNKA in thin limb plays a role in maintaining salt and water homeostasis. 1
Protein families：