OPN5_MOUSE Q6VZZ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6VZZ7
Recommended name：Opsin-5
EC number：
Alternative names：(G-protein coupled receptor 136) (G-protein coupled receptor PGR12) (Neuropsin)
Cleaved into：
GeneID：353344
Gene names (primary )：Opn5
Gene names (synonym )：Gpr136 Pgr12
Gene names (ORF )：
Length：377
Mass：42018
Sequence：MALNHTALPQDERLPHYLRDEDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWFGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAVIWAYASFWTTMPLVGLGDYAPEPFGTSCTLDWWLAQASGGGQVFILSILFFCLLLPTAVIVFSYAKIIAKVKSSSKEVAHFDSRIHSSHVLEVKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYRFACCQAGGLRGTKKKSLEDFRLHTVTAVRKSSAVLEIHPESSSRFTSAHVMDGESHSNDGDCGKK
Tissue specificity：Expressed in the brain (at protein level) (PubMed:14623103, PubMed:22043319). Weakly expressed in the skin and liver (at protein level) (PubMed:22043319). Abundantly expressed in striated muscle cells (PubMed:22043319). Expressed in Math7/Atok7-dependent retinal ganglion cells in the ganglion cell layer (at protein level) (PubMed:14623103, PubMed:22043319, PubMed:26392540, PubMed:30240620, PubMed:31607531). Additionally expressed in horizontal and amacrine cells in the inner nuclear layer of the retina (at protein level) (PubMed:22043319). Expressed around the base of hair follicles and in epidermal and sebaceous gland cells of the outer ear (at protein level) (PubMed:22043319, PubMed:31607531). Abundantly expressed in vibrissae hair follicles and weakly expressed in the vibrissae skin pad, dorsal back skin, and tail (PubMed:31607531). {ECO:0000269|PubMed:14623103, ECO:0000269|PubMed:22043319, ECO:0000269|PubMed:26392540, ECO:0000269|PubMed:30240620, ECO:0000269|PubMed:31607531}.
Induction：
Developmental stage：Expressed weakly in the inner retina at postnatal day 5 (P5), with expression becoming abundant in retinal ganglion cells at P8 (PubMed:30936473). Expressed throughout the retinal sublaminae layers, with abundant expression in the ganglion cell layer and nerve fiber layer at P12 (PubMed:30936473). Expressed in ganglion cells in the optic tracts, superior colliculus and lateral geniculate nucleus of the brain at P28 (PubMed:30936473). Expressed around the base of hair follicles in the dorsal ear skin, in the vibrissal nose pad, and weakly expressed below the epidermis in the vibrissal nose pad at P8 (PubMed:31607531). {ECO:0000269|PubMed:30936473, ECO:0000269|PubMed:31607531}.
Protein families：G-protein coupled receptor 1 family, Opsin subfamily