LFG2_RAT O88407
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88407
Recommended name：Protein lifeguard 2
EC number：
Alternative names：
Cleaved into：
GeneID：246274
Gene names (primary )：Faim2
Gene names (synonym )：Lfg, Lfg2, Nmp35
Gene names (ORF )：
Length：316
Mass：35,036
Sequence：MTQGKLSVANKAPGTEGQQQANGEKKDAPAVPSAPPSYEEATSGEGLKAGAFPQGPTAVPLHPSWAYVDPSSSSGYEGGFPAGHHELFSTFSWDDQKVRQLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTIFSFQTKFDFTSCHGVLFVLLMTLFFSGLLLAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE
Tissue specificity：Expressed at high levels on dendrites and to a lesser extent on the soma and axons of neurons in various regions of brain. 1
Induction：
Developmental stage：Low expression was detected in brain and spinal cord at birth, increasing with age to highest levels in postnatal days 60 (P60). 1
Protein families：