LGMN_MOUSE   O89017


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O89017

Recommended name:Legumain

EC number:EC 3.4.22.34

Alternative names:(Asparaginyl endopeptidase) (Protease, cysteine 1)

Cleaved into:

GeneID:19141

Gene names  (primary ):Lgmn

Gene names  (synonym ):Prsc1

Gene names  (ORF ):

Length:435

Mass:49373

Sequence:MTWRVAVLLSLVLGAGAVPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHY

Tissue specificity:Detected in kidney proximal tubules (at protein level). Ubiquitous. Particularly abundant in kidney and placenta. {ECO:0000269|PubMed:21292981, ECO:0000269|PubMed:9742219}.

Induction:

Developmental stage:

Protein families:Peptidase C13 family


   💬 WhatsApp