SHFL_RAT   Q5RJN4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5RJN4

Recommended name:Shiftless antiviral inhibitor of ribosomal frameshifting protein homolog Curated

EC number:

Alternative names:Repressor of yield of DENV protein homolog By Similarity (RyDEN By Similarity)

Cleaved into:

GeneID:

Gene names  (primary ):Shfl

Gene names  (synonym ):Ryden By Similarity

Gene names  (ORF ):

Length:163

Mass:18,865

Sequence:MAQDGVELEKSVRRLREKFHGKVSPKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDQDIQAVATSLLPLTQANLRMFQRAQDDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKCRKRYEPVPNDKMWGLAEFHCPKCRHNFR

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp