VISTA_MOUSE   Q9D659


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D659

Recommended name:V-type immunoglobulin domain-containing suppressor of T-cell activation

EC number:

Alternative names:(Platelet receptor Gi24) (V-set domain-containing immunoregulatory receptor) (V-set immunoregulatory receptor)

Cleaved into:

GeneID:74048

Gene names  (primary ):Vsir

Gene names  (synonym ):Dies1 PD-1H VISTA

Gene names  (ORF ):

Length:308

Mass:33559

Sequence:MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAI

Tissue specificity:Expressed in spleen, thymus, bone marrow, lymph node, and in T-cells within the lamina propria of the small intestine (PubMed:21768399). Detected on CD4+ and CD8+ T-cells, bone marrow-derived dendritic cells (BMDCs), peritoneal macrophages, neutrophils, and natural killer (NK) cells (PubMed:21768399). In spleen and lymph nodes, highly expressed on CD4+ T-cell populations, and at lower levels on CD8+ T-cells (PubMed:21383057). In thymus, has low expression on CD4+ cells and CD8+ cells, and not detected on CD4+CD8+ cells (PubMed:21383057). Expressed in splenic and peritoneal CD11b cells (PubMed:21383057). Not detected in most B cells and NK cells (at protein level) (PubMed:21383057). Also detected at lower levels in non-hematopoeitic tissues such as heart, brain, lung, kidney, muscle, ovary, and testis (PubMed:21768399, PubMed:21383057). {ECO:0000269|PubMed:21383057, ECO:0000269|PubMed:21768399}.

Induction:Up-regulated by phorbol 12-myristate 13-acetate (PMA) and the cytokine IFNG. {ECO:0000269|PubMed:21768399}.

Developmental stage:Detected in 7-day and 17-day embryos. {ECO:0000269|PubMed:21768399}.

Protein families:


   💬 WhatsApp