CK097_RAT   D3ZF18


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3ZF18

Recommended name:Uncharacterized protein C11orf97 homolog Curated

EC number:

Alternative names:

Cleaved into:

GeneID:500945

Gene names  (primary ):UP000002494

Gene names  (synonym ):

Gene names  (ORF ):

Length:124

Mass:13,981

Sequence:MRRQEALVVTAGTASEASRDGEQPRPAGLVCRARVEPGGPQESRQQWKTFLYCEPHKRIKEVLEEELSIKRDECHVKSPTAVALDGIWSIRRNLPVGGMIPGQQSRNCSLPQTKYYSRHGGLRR

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp