TSGA8_MOUSE   Q9JJL0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JJL0

Recommended name:Testis-specific gene A8 protein

EC number:

Alternative names:(Haploid-specific alanine-rich acidic protein located on chromosome X) (Halap-x)

Cleaved into:

GeneID:100502723

Gene names  (primary ):Tsga8

Gene names  (synonym ):Halapx

Gene names  (ORF ):

Length:238

Mass:22769

Sequence:MDVPTSSTDSQEVKPIMPIRTKAACKFYPPHILCGKGAKTNKRGKRGGAQKASTKKDIGETTPPVAKKSKVAKEPTMLAAAAAPEAAASPESSAAAAAPEAAASPESSAAAAAPEAAASPESSAAAAAPEAAASLESSAAAAAPEAAAAPATPAAPEAAAAPEVAAAPATPAAPEATAAPAAPEAATTPAAPEAPAAAPAVEEEEMVWEAAAVVGEAAVKPPEEEPTSGEAVATTTMT

Tissue specificity:Specifically expressed in testis (at protein level). {ECO:0000269|PubMed:10993819}.

Induction:

Developmental stage:Detected in testis from 18 days onwards. In developing spermatazoa, expressed from the round spermatid stage through to the terminal stages of spermiogenesis, when expression declines. {ECO:0000269|PubMed:10993819}.

Protein families:


   💬 WhatsApp