PCID2_MOUSE Q8BFV2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BFV2
Recommended name：PCI domain-containing protein 2
EC number：
Alternative names：(CSN12-like protein)
Cleaved into：
GeneID：234069
Gene names (primary )：Pcid2
Gene names (synonym )：
Gene names (ORF )：
Length：399
Mass：46132
Sequence：MAHITINQYLQQVYEAIDTRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRIFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRITYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTIELLRKYHLMQFSEVTKAVSEGNLLLLNEALAKHETFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMHVEDVDIDEVQCILANLIYMGHIKGYISHQHQKLVVSKQNPFPPLSTVC
Tissue specificity：
Induction：
Developmental stage：In B lineage cells, expressed in a stage-dependent manner at high levels in bone marrow pre-B and immature B-cells, and in spleen transitional 1 and follicular B-cells, but at lower levels in pro-B, transitional 2, and marginal zone B-cells. {ECO:0000269|PubMed:20870947}.
Protein families：CSN12 family