PHB1_RAT P67779
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P67779
Recommended name：Prohibitin 1
EC number：
Alternative names：
Cleaved into：
GeneID：25344
Gene names (primary )：Phb1
Gene names (synonym )：Phb
Gene names (ORF )：
Length：272
Mass：29,820
Sequence：MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Tissue specificity：Expressed in brain, heart, intestine, kidney, liver, skeletal muscle. Highest levels in heart, liver, kidney and intestine. Also expressed in flagella of epididymal sperm. Expressed in lung tissue and pulmonary artery smooth muscle (at protein level) (PubMed:32173312). 3 s
Induction：Throughout gestation, highly expressed in brown fat, heart, liver, developing renal tubules and neurons, and detected at lower levels in tissues such as lung and exocrine pancreas. 1 Publication
Developmental stage：Induced by PDGF. 1
Protein families：