ACKR3_RAT   O89039


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O89039

Recommended name:Atypical chemokine receptor 3 Curated

EC number:

Alternative names:

Cleaved into:

GeneID:84348

Gene names  (primary ):Ackr3

Gene names  (synonym ):Cmkor1, Cxcr7, Rdc1

Gene names  (ORF ):

Length:362

Mass:41,650

Sequence:MDVHLFDYVEPGNYSDINWPCNSSDCIVVDTVQCPAMPNKNVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKITHLIFSINLFGSIFFLACMSVDRYLSITYFTSTSSYKKKMVRRVVCVLVWLLAFFVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMSASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQNTK

Tissue specificity:Expressed in vascular smooth muscle cells (at protein level). In brain, expressed in blood vessels, pyramidal cells in hippocampal subfield CA3, mature dentate gyrus granule cells, ventricle walls, olfactory bulb, accumbens shell, supraoptic, lateroanterior and ventromedial hypothalamic nuclei, medial region of thalamus, and motor nuclei, central gray and raphe magnus nucleus of brain stem. Detected in primary neurons, GABAergic neurons, astrocytes, cerebral cortex, ventral striatum and choroid plexus. Not detected in mesencephalon. 4 s

Induction:Expressed in the ventral and dorsal parts of telencephalon at all developmental stages of brain analyzed (14 dpc to P56). Strong expression detected in the cranial connective tissue surrounding the brain at 14 dpc to 15 dpc. In the cortex, expressed mainly in the marginal zone at preplate stage (14 dpc), with expression increasing strongly in the marginal zone/layer I between 15 dpc and 18 dpc and declining rapidly in layer I after P0. Expression emerges in the lateral part of cortical plate at 15 dpc and increases in the medial and lateral parts between 15 dpc and 17 dpc. Expression not detected in the cortical ventricular and subventricular zones at the early embryonic stages but emerges at 18 dpc. Expressed in GABAergic precursors and in some reelin-expressing Cajal-Ratzius cells, in neurons forming the cortical plate and sparsely in the developing dentate gyrus and cerebellar external germinal layer. In the ventral telencephalon, expressed in the germinative zone of the ganglionic eminences and in GABAergic neurons forming the caudate putamen between 14 dpc and 18 dpc. 1 Publication

Developmental stage:By ischemia. Up-regulated in the cingulate, retrosplenial and frontal areas of the cortex ipsilateral to middle cerebral artery occlusion (MCAO) by 163% at 6 hours, 220% at 2 days and 89% at 4 days after ischemia-onset, with expression reduced back to control level at 10 days after MCAO. Expression is almost undetectable in the infarct area between days 2 and 10 after MCAO. 1

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp