AP4M1_MOUSE Q9JKC7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKC7
Recommended name：AP-4 complex subunit mu-1
EC number：
Alternative names：(AP-4 adaptor complex mu subunit) (Adaptor-related protein complex 4 subunit mu-1) (Mu subunit of AP-4) (Mu-adaptin-related protein 2) (mu-ARP2) (Mu4-adaptin) (mu4)
Cleaved into：
GeneID：11781
Gene names (primary )：Ap4m1
Gene names (synonym )：
Gene names (ORF )：
Length：449
Mass：49509
Sequence：MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGGESPVVMYHGDRHFIHIRHSGLYLVATTLENVSPFSLLELLSRLATLLGDYCGSLNEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQNKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEICIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDQGSGRLQVYLKLRCDLPPKSQALNIHLHLPLPRGVISLSQELSSPDQKAELGEGALHWDLPRVQGGSQLSGLFQMDVPGLQGLPNHGPSPLGLGPASLSFELPRHTCSGLQVRFLRLSFSACGNANPHKWVRHLSHSNAYVIRI
Tissue specificity：
Induction：
Developmental stage：
Protein families：Adaptor complexes medium subunit family