SEPP1_RAT P25236
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25236
Recommended name：Selenoprotein P 1 Publication
EC number：
Alternative names：Selenoprotein Se-P10 Selenoprotein Se-P6 Selenoprotein Se-P2 Selenoprotein Se-P1
Cleaved into：
GeneID：29360
Gene names (primary )：Selenop
Gene names (synonym )：Selp Imported, Sepp1
Gene names (ORF )：
Length：385
Mass：43,083
Sequence：MWRSLGLALALCLLPYGGAESQGQSPACKQAPPWNIGDQNPMLNSEGTVTVVALLQASUYLCLLQASRLEDLRIKLENQGYFNISYIVVNHQGSPSQLKHAHLKKQVSDHIAVYRQDEHQTDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEKRCGNCSFTSLEDEAFCKNVSSATASKTTEPSEEHNHHKHHDKHGHEHLGSSKPSENQQPGALDVETSLPPSGLHHHHHHHKHKGQHRQGHLESUDMGASEGLQLSLAQRKLURRGCINQLLCKLSEESGAATSSCCCHCRHLIFEKSGSAITUQCAENLPSLCSUQGLFAEEKVIESCQCRSPPAAUHSQHVSPTEASPNUSUNNKTKKUKUNLN
Tissue specificity：Widely expressed, mainly by the liver. Secreted in plasma.
Induction：
Developmental stage：
Protein families：selenoprotein P family