AAKG1_MOUSE   O54950


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54950

Recommended name:5'-AMP-activated protein kinase subunit gamma-1

EC number:

Alternative names:(AMPK gamma1) (AMPK subunit gamma-1) (AMPKg)

Cleaved into:

GeneID:19082

Gene names  (primary ):Prkag1

Gene names  (synonym ):Prkaac

Gene names  (ORF ):

Length:330

Mass:37520

Sequence:MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP

Tissue specificity:

Induction:

Developmental stage:

Protein families:5'-AMP-activated protein kinase gamma subunit family


   💬 WhatsApp