SIR6_MOUSE   P59941


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P59941

Recommended name:NAD-dependent protein deacetylase sirtuin-6

EC number:EC 2.3.1.286

Alternative names:(Regulatory protein SIR2 homolog 6) (SIR2-like protein 6)

Cleaved into:

GeneID:50721

Gene names  (primary ):Sirt6

Gene names  (synonym ):Sir2l6

Gene names  (ORF ):

Length:334

Mass:36920

Sequence:MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLMWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECPKCKTQYVRDTVVGTMGLKATGRLCTVAKTRGLRACRGELRDTILDWEDSLPDRDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS

Tissue specificity:Highest levels are found in muscle, thymus, spleen, brain and heart (at protein level). {ECO:0000269|PubMed:15795229, ECO:0000269|PubMed:16439206}.

Induction:

Developmental stage:Expression peaks at embryonic day 11 and persists into adulthood. {ECO:0000269|PubMed:15795229}.

Protein families:Sirtuin family, Class IV subfamily


   💬 WhatsApp