KCIP2_RAT Q9JM59
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JM59
Recommended name:A-type potassium channel modulatory protein KCNIP2 Curated
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Kcnip2
Gene names (synonym ):Kchip2 1 Publication
Gene names (ORF ):
Length:270
Mass:30,933
Sequence:MRGQGRKESLSESRDLDGSYDQLTGHPPGPSKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRPLDPDSVEDEFELSTVCHRPEGLEQLQEQTKFTRRELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSNYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTIDDRLSWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQQDENIMRSMQLFDNVI
Tissue specificity:Expressed in heart, brain and lung. In brain, abundantly expressed in striatum, hippocampus and olfactory bulb, moderately expressed in cerebral cortex and lowly expressed in thalamus and hypothalamus. Isoform 1 is predominant in cerebral cortex, striatum and hippocampus. Isoform 1, isoform 2 and isoform 3 are equally expressed in olfactory bulb. Iisoform 3 is expressed at high levels and isoform 1 at low levels in heart (in PubMed:11263977). 4 s
Induction:
Developmental stage:
Protein families: