ZPBP2_MOUSE   Q6X786


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6X786

Recommended name:Zona pellucida-binding protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:69376

Gene names  (primary ):Zpbp2

Gene names  (synonym ):

Gene names  (ORF ):

Length:326

Mass:37116

Sequence:MLAWALLYAVLWSLAGVGSQRSSLFNIKGFVYGTVGHPVKIYVKLHQASPVLICMDIDRANKETVDPTYLWTGPNENTLKGNSQINITNTGELVLKDFLEPLSGLYSCMLSYKTIKAETQEETMIKKKYDFLVFAYREPDYSYHMAVRFTTGSCVGRHNDLLFRVLKKILDNLISDLLCHVIEPSYKCHFVKLPERDFLYELFIAFQVNPFAPGWRSLCNRSADCEDITNHNVLKARDRMEEFFRKQAHILHHHFNRTVPAMHFVDHSFQVTRIDNCRPGFGKNEGLHSNCATCCVVCSPGTFSPDVDVTCQICVSVHIYGAKACP

Tissue specificity:Expressed specifically in male germ cells. {ECO:0000269|PubMed:17664285}.

Induction:

Developmental stage:Expressed from the mid-pachytene spermatocyte stage to the early elongating spermatid stage. {ECO:0000269|PubMed:17664285}.

Protein families:Zona pellucida-binding protein Sp38 family


   💬 WhatsApp