STA10_MOUSE Q9JMD3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JMD3
Recommended name：START domain-containing protein 10
EC number：
Alternative names：(StARD10) (PCTP-like protein) (PCTP-L) (Serologically defined colon cancer antigen 28 homolog) (StAR-related lipid transfer protein 10)
Cleaved into：
GeneID：56018
Gene names (primary )：Stard10
Gene names (synonym )：Pctpl Sdccag28 Sdccagg28
Gene names (ORF )：
Length：291
Mass：32951
Sequence：MEKPAASTEPQGSRPALGRESVQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVTESREERAGGAGGEGSDDDTSLT
Tissue specificity：Testis, kidney, liver, and intestine with the highest level in the testis.
Induction：
Developmental stage：During male germ cell development, it was detected first in the 23-day-old mouse testis, and the signal increased with age.
Protein families：