MCSP_RAT   Q64298


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64298

Recommended name:Sperm mitochondrial-associated cysteine-rich protein

EC number:

Alternative names:

Cleaved into:

GeneID:24899

Gene names  (primary ):Smcp

Gene names  (synonym ):Mcs, Mcsp

Gene names  (ORF ):

Length:145

Mass:15,148

Sequence:MSDSSKTNQCCPTPCCPPKPCCPPKPCCLQKSPCCPKSPCCPPKSPCCTPKVCPCPTPCPCPATCPAACACPCPMKPCCPTKCTCCPKKCTCCPQPTCCVQPTCCSSENKTESDSDGSGQTQDRGAQTQQSPQGGQGNWNQKKTK

Tissue specificity:Testis. Selectively expressed in the spermatids of seminiferous tubules and in flagella of epididymal sperm. 2 s

Induction:

Developmental stage:Expressed in postmeiotic cells. 1

Protein families:


   💬 WhatsApp