CCR2_MOUSE P51683
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51683
Recommended name：C-C chemokine receptor type 2
EC number：
Alternative names：(C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (JE/FIC receptor) (MCP-1 receptor) (CD antigen CD192)
Cleaved into：
GeneID：12772
Gene names (primary )：Ccr2
Gene names (synonym )：Cmkbr2
Gene names (ORF )：
Length：373
Mass：42783
Sequence：MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPPLYSLVFIFGFVGNMLVIIILIGCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVVAVFASLPGIIFTKSKQDDHHYTCGPYFTQLWKNFQTIMRNILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTTFQESLGMSNCVIDKHLDQAMQVTETLGMTHCCINPVIYAFVGEKFRRYLSIFFRKHIAKRLCKQCPVFYRETADRVSSTFTPSTGEQEVSVGL
Tissue specificity：Epressed in mature thymocytes (PubMed:29930553). Detected in monocyte/macrophage cell lines, but not in nonhematopoietic cell lines (PubMed:8631787). {ECO:0000269|PubMed:29930553, ECO:0000269|PubMed:8631787}.
Induction：Up-regulated in the dopamine D1 and D2 receptor-containing neurons of nucleus accumbens shell after spinal nerve ligation. {ECO:0000269|PubMed:29993042}.
Developmental stage：
Protein families：G-protein coupled receptor 1 family