ABCB9_RAT   Q9QYJ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QYJ4

Recommended name:ABC-type oligopeptide transporter ABCB9 By Similarity

EC number:EC:7.4.2.6

Alternative names:ATP-binding cassette sub-family B member 9 ATP-binding cassette transporter 9 (ABC transporter 9 protein) TAP-like protein 1 Publication (TAPL 1 Publication)

Cleaved into:

GeneID:

Gene names  (primary ):Abcb9

Gene names  (synonym ):

Gene names  (ORF ):

Length:762

Mass:84,033

Sequence:MRLWKAVVVTLAFVSMDVGVTTAIYAFSHLDRSLLEDIRHFNIFDSVLDLWAACLYRSCLLLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIYAMAKLLLFSEVRRPIRDPWFWALFVWTYISLAASFLLWGLLATVRPDAEALEPGNEGFHGEGGAPAEQASGATLQKLLSYTKPDVAFLVAASFFLIVAALGETFLPYYTGRAIDSIVIQKSMDQFTTAVVVVCLLAIGSSLAAGIRGGIFTLVFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINIFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQSALARASTTAEETISAMKTVRSFANEEEEAEVFLRKLQQVYKLNRKEAAAYMSYVWGSGLTLLVVQVSILYYGGHLVISGQMSSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGRLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLQGGRVLLDGEPIGAYDHKYLHRVISLVSQEPVLFARSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQRHTVLIIAHRLSTVERAHLIVVLDKGRVVQQGTHQQLLAQGGLYAKLVQRQMLGLEHPLDYTAGHKEPPSNTEHKA

Tissue specificity:Found in testis, particularly in the Sertoli cells of the seminiferous tubules. Also expressed in kidney, brain, heart, lung, spleen, thymus, intestine and testis. Higher expression detected in brain and testis than in thymus and intestine. 2 s

Induction:

Developmental stage:

Protein families:ABC transporter superfamily


   💬 WhatsApp