NP1L2_MOUSE P51860
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51860
Recommended name:Nucleosome assembly protein 1-like 2
EC number:
Alternative names:(Brain-specific protein, X-linked)
Cleaved into:
GeneID:17954
Gene names (primary ):Nap1l2
Gene names (synonym ):Bpx
Gene names (ORF ):
Length:460
Mass:52158
Sequence:MAESVDHKELSESNQEELGSQVMAEGPGESQDRSEGVSIEPGDGGQHGEETVAAGVGEEGKGEEAAAGSGEDAGKCGGTDEDSDSDRPKGLIGYLLDTDFVESLPVKVKCRVLALKKLQTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEYKSDCEDYFEEEMDEEEETNGNEDGMVHEYVDEDDGYEDCYYDYDDEEEEEEEDDSAGATGGEEVNEEDPKGIPDFWLTVLKNVEALTPMIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLACYDPHPYRGTAIEYATGCDIDWNEGKNVTLRTIKKKQRHRVWGTVRTVTEDFPKDSFFNFFSPHGISLNGGDENDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDEIYDKIIYDDWMAAIEEVKACCKNLEALVEDIDR
Tissue specificity:Brain, specifically expressed in neurons.
Induction:
Developmental stage:First expressed around the day 7 embryo.
Protein families:Nucleosome assembly protein (NAP) family