CXCR5_RAT P34997
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P34997
Recommended name:C-X-C chemokine receptor type 5
EC number:
Alternative names:Burkitt lymphoma receptor 1 homolog Neurolymphatic receptor (NLR)
Cleaved into:
GeneID:29363
Gene names (primary ):Cxcr5
Gene names (synonym ):Blr1
Gene names (ORF ):
Length:374
Mass:42,013
Sequence:MNSPISLDMGAITYNMDDLYKELAIYSNSTEIPLQDSIFCSTEEGPLLTSFKTIFMPVAYSLIFLLGMMGNILVLVILERHRHTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTFLCKTVIALHKINFYCSSLLLACIAVDRYLAIVHAVHAYRRRRLLSIHITCSTIWLAGFLFALPELLFAKVVQPHNNESLPQCIFSQENEAETRAWFASRFLYHTGGFLLPMLVMAWCYVGVVHRLLQAQRRPQRQKAVRVAILVTSIFLLCWSPYHIVIFLDTLERLKAVNSSCELSGYLSVAITLCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCAGPASLCQLFPGWRKSSLSESENATSLTTF
Tissue specificity:Expressed in neuronal and lymphatic tissue.
Induction:
Developmental stage:
Protein families: