LITAF_RAT   P0C0T0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C0T0

Recommended name:Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog

EC number:

Alternative names:Estrogen-enhanced transcript protein 1 (Eet-1)

Cleaved into:

GeneID:65161

Gene names  (primary ):Litaf

Gene names  (synonym ):

Gene names  (ORF ):

Length:161

Mass:17,030

Sequence:MSAPGPYQAAAGPSVMPTAPPTYEETVGVNSYYPTPPAPQPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTVYVQQPISFYDRPIQMCCPSCNKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL

Tissue specificity:Widely expressed. 1

Induction:

Developmental stage:By estrogen in vagina, cervix, uterus and kidney. 1

Protein families:


   💬 WhatsApp