SOX13_MOUSE   Q04891


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q04891

Recommended name:Transcription factor SOX-13

EC number:

Alternative names:(SRY (Sex determining region Y)-box 13) (mSox13)

Cleaved into:

GeneID:20668

Gene names  (primary ):Sox13

Gene names  (synonym ):Sox-13

Gene names  (ORF ):

Length:613

Mass:68168

Sequence:MSMQSPVSVQLAPDSASTMVNCTIKSEEKKEPCHEAPQGAAPAVETQPGDPALASQDATNAKAPPQDCASPESSGSPEPKRPAASEAASGSQERLDFNRNLQEVVPAIEKLLSSDWKERFLGRSNVEAKDVKGTQESLAEKELQLLVMIHQLSALRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRSGVAAHHPLQEPPQPLNLTAKPKVPELPNTSSSPSLKMNSCGPRPASHGAPTRDLQSSPPSLPLGFLGEGDAVTKAIQDARQLLHSHSGALENSPNTPFRKDLISLDSSPAKERLEESCVHPLEEAMLSCDMDGSRHFSESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCVVEGRRLRVGEYKALMRTRRQGARQSYTIPPQAGQAQVSSDILFPRAAGLPLARPLVEHYDPQGLDPNMPVIINTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGDEKSDEELVVLTD

Tissue specificity:Expressed in beta-cells in pancreatic islets of Langerhans (at protein level) (PubMed:10871192). Expressed in a subset of invariant natural killer (iNK) T-cells (at protein level) (PubMed:30413363). Expressed in oligodendroglial cells in the spinal cord (at protein level) (PubMed:26525805). In the hematopoietic system, expressed in gamma-delta T-cell lineage, specifically in immature Vgamma2-positive gamma-delta thymocytes, with expression decreasing upon maturation (PubMed:17218525, PubMed:23562159, PubMed:30413363). Expressed in DN1d cells, a subset of DN1 (TCR, CD4 and CD8 negative, also known as TN1) thymocyte progenitors, and in DN2 (also known as TN2) thymocyte progenitors (PubMed:17218525, PubMed:30413363). Expressed in the ovary and kidney (PubMed:9524265). Expressed in the peripheral lymphoid organs (PubMed:17218525). {ECO:0000269|PubMed:10871192, ECO:0000269|PubMed:17218525, ECO:0000269|PubMed:23562159, ECO:0000269|PubMed:26525805, ECO:0000269|PubMed:30413363, ECO:0000269|PubMed:9524265}.

Induction:

Developmental stage:Expressed in the visceral mesoderm of the yolk sac from 9.5 dpc to 15.5 dpc (at protein level) (PubMed:16835393, PubMed:30413363). Expressed in the sclerotome of developing somites and the derivative vertebrae and ribs between 9.5 dpc and 12.5 dpc (PubMed:16835393). Expressed in the rostral perichondrial area and mesenchyme of the limb bud in the prospective arm region and hand plate at 10.5 dpc, proximal mesenchyme expression in the forelimb then decreases between 11.5 dpc and 12.5 dpc until expression is consolidated to the arm regions of the developing limb at 12.5 dpc and forelimb digits at 13.5 dpc (PubMed:16835393). Expressed at variable levels in the prospective forebrain to the hindbrain and all neural tube cell layers from 9.5 dpc to postnatal day 6 (P6) (PubMed:16835393, PubMed:26525805). Expressed in immature oligodendrocyte precursor cells and astrocytes at 15.5 dpc, additionally expressed in precursor and differentiating oligodendrocytes in the neural tube from 18.5 dpc to P6 (PubMed:26525805). Highly expressed in embryonic arterial walls at 13.5 dpc (PubMed:9421502). Low levels are found in the inner ear at 13.5 dpc and in some cells in the thymus at 16.5 dpc (PubMed:9421502). Initially expressed in the hair follicles of the whisker pad vibrissae at 14.5 dpc, expression continues in the hair placode and in hair germ and peg during hair follicle morphogenesis to 18 dpc (PubMed:9421502, PubMed:30638933). Expressed in the newborn hair follicle epithelial sheath, this expression weakens at P15, reexpressed in the hair follicle bulge and secondary germ regions at P22, with expression continuing in the root sheath of the hair follicle at P28 (PubMed:30638933). Expressed in trophoblast giant cells of the spongiotrophoblast and labyrinth layers of the placenta at 15.5 dpc (PubMed:16835393). Expressed in DN1d cells, a subset of DN1 precursor thymocytes, from 16 dpc onwards (PubMed:30413363). Expressed in the tracheal epithelium below the vocal cord at 18 dpc (PubMed:9421502). Expression is transiently increased during brown adipocyte differentiation (PubMed:27923061). {ECO:0000269|PubMed:16835393, ECO:0000269|PubMed:26525805, ECO:0000269|PubMed:27923061, ECO:0000269|PubMed:30413363, ECO:0000269|PubMed:30638933, ECO:0000269|PubMed:9421502}.

Protein families:


   💬 WhatsApp