MINY1_RAT   Q5BJQ2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BJQ2

Recommended name:Ubiquitin carboxyl-terminal hydrolase MINDY-1

EC number:EC:3.4.19.12

Alternative names:Deubiquitinating enzyme MINDY-1 Protein FAM63A

Cleaved into:

GeneID:310665

Gene names  (primary ):Mindy1

Gene names  (synonym ):Fam63a

Gene names  (ORF ):

Length:482

Mass:52,729

Sequence:MEQPQAECPAPSKTNSAETVESEKHEALSGPEKHPQDKDGADAAPEKHPQDKDGADAHGEAGKQKSGDQTLPPVQDGGNLECPPPEASSSPPGPACGIPSEVETTEACSRPQQLPQSPRIQQPDLDFYCVKWIPWKGERTPIITQSSNGPCPLLAIMNILFLQWKVKLPPQKEVITSDELLTHLGNCLLSIKPQEKSEGLQLNFQQNVGDAMTVLPKLATGLDVNVRFTGVSDFEYTPECSVFDLLGVPLYHGWLVDPQSPEAVSAVGKLSYNQLVEKIIICKHSSDSNLVTEGLIAEQFLETTAAQLTYHGLCELTATAKEDELSVFFRNNHFSTMTKHKSHLYLLVTDQGFLQEEQVVWESLHNVDGDSCFCDSDFHLSHSLGKSHGAEGGSGSPEKQLQVDQDYLIALSLQQQQQPQGMLGLSDLELAQQLQQEEYQQQQAVQPVRTRAPSSPGRGATSGRPAGERRQRSKTESDCVLL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp