HXA10_MOUSE P31310
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31310
Recommended name:Homeobox protein Hox-A10
EC number:
Alternative names:(Homeobox protein Hox-1.8)
Cleaved into:
GeneID:15395
Gene names (primary ):Hoxa10
Gene names (synonym ):Hox-1.8 Hoxa-10
Gene names (ORF ):
Length:416
Mass:43292
Sequence:MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGVGGGSAGGGGGGYYAHGGVYLPPASDLPYGLQSCGLFPALGSKRNEAPSPGGGGGGGSGGLGPGTHGYAPAPLDLWLDAPRSCRMEPPDGPPPPQPQPQQQQQQPPPPPPQPPQPQPQATSCSFAQNIKEESSYCLYDAADKCPKGSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQAYGTAKGFGSGGGGTQQLASPFPAQPPGRGFDPPPALASGSTEAAGKERVLDSTPPPTLVCTGGGGSQGDEEAHASSSAAEELSPAPSENSKASPEKDSLGSSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Tissue specificity:Expressed in the developing limb bud where it is restricted to the mesenchyme along the proximal-distal axis. Also found in developing gut and urogenital tract. In adult tissue, both forms found in kidney but only isoform 1 is expressed in skeletal muscle.
Induction:
Developmental stage:Embryonic expression increases from day 9 to day 12 and then declines to day 15.
Protein families:Abd-B homeobox family